CAMLG purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2295134
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CAMLG protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: CAMLG (NP_001736.1, 1 a.a. ~ 296 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGSEVP
• NCBI: NP_001736.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CAMLG MaxPab rabbit polyclonal antibody. Western Blot analysis of CAMLG expression in HepG2.

CAMLG MaxPab rabbit polyclonal antibody. Western Blot analysis of CAMLG expression in human spleen.

Western Blot analysis of CAMLG expression in transfected 293T cell line by CAMLG MaxPab polyclonal antibody. Lane 1: CAMLG transfected lysate(33.00 KDa). Lane 2: Non-transfected lysate.