CAMLG purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2295135
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human CAMLG protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Rat
• Immunogen: CAMLG (NP_001736.1, 1 a.a. ~ 296 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSSDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGSEVP
• NCBI: NP_001736.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CAMLG MaxPab polyclonal antibody. Western Blot analysis of CAMLG expression in A-431.

CAMLG MaxPab polyclonal antibody. Western Blot analysis of CAMLG expression in rat brain.

Western Blot analysis of CAMLG expression in transfected 293T cell line by CAMLG MaxPab polyclonal antibody. Lane 1: CAMLG transfected lysate(32.56 KDa). Lane 2: Non-transfected lysate.