CAMKK2 monoclonal antibody (M01), clone 1A11

• Catalog Number: orb2291514
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CAMKK2.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1A11
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: CAMKK2 (AAH26060, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSP
• NCBI: AAH26060
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CAMKK2 monoclonal antibody (M01), clone 1A11 Western Blot analysis of CAMKK2 expression in IMR-32.

CAMKK2 monoclonal antibody (M01), clone 1A11. Western Blot analysis of CAMKK2 expression in K-562.

Detection limit for recombinant GST tagged CAMKK2 is approximately 1 ng/ml as a capture antibody.

Immunoprecipitation of CAMKK2 transfected lysate using anti-CAMKK2 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CAMKK2 MaxPab rabbit polyclonal antibody.

Western Blot analysis of CAMKK2 expression in transfected 293T cell line by CAMKK2 monoclonal antibody (M01), clone 1A11. Lane 1: CAMKK2 transfected lysate(59.6 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (39.93 KDa).