CAMK2A monoclonal antibody (M01), clone 2C4

• Catalog Number: orb2295160
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CAMK2A.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CAMK2A (AAH40457, 305 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: TTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPV
• Tested applications: ELISA, IF, WB
• Clone Number: 2C4
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH40457

CAMK2A monoclonal antibody (M01), clone 2C4. Western Blot analysis of CAMK2A expression in human stomach.

CAMK2A monoclonal antibody (M01), clone 2C4. Western Blot analysis of CAMK2A expression in RIN-m5F.

Detection limit for recombinant GST tagged CAMK2A is approximately 3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CAMK2A on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot detection against Immunogen (37.29 KDa).