CAMK2A monoclonal antibody (M01), clone 2C4

• Catalog Number: orb2295160
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CAMK2A.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2C4
• Tested applications: ELISA, IF, WB
• Reactivity: Human, Rat
• Isotype: IgG2a Kappa
• Immunogen: CAMK2A (AAH40457, 305 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TTMLATRNFSGGKSGGNKKSDGVKESSESTNTTIEDEDTKVRKQEIIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKPV
• NCBI: AAH40457
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CAMK2A monoclonal antibody (M01), clone 2C4. Western Blot analysis of CAMK2A expression in human stomach.

CAMK2A monoclonal antibody (M01), clone 2C4. Western Blot analysis of CAMK2A expression in RIN-m5F.

Detection limit for recombinant GST tagged CAMK2A is approximately 3 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CAMK2A on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot detection against Immunogen (37.29 KDa).