You have no items in your shopping cart.
Cart summary
Calreticulin Protein, Pig, Recombinant (His)
Catalog Number: orb1976815
| Catalog Number | orb1976815 |
|---|---|
| Category | Proteins |
| Description | Calreticulin Protein, Pig, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 48.6 kDa and the accession number is P28491. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 48.6 kDa (predicted) |
| UniProt ID | P28491 |
| Protein Sequence | EPTIYFKEQFLDGDGWTDRWIESKHKPDFGRFVLSSGKFYGDQEKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPDGLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAVKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDSNIYAYENFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEEKKRKEEEEVDKEDEEDKDEDEEEEDEKEEEEEEDAAAGQAKDEL |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Sus scrofa (Pig) |
| Biological Activity | Calreticulin Protein, Pig, Recombinant (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 48.6 kDa and the accession number is P28491. |
| Expression Region | 18-417 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
