You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295168 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full length recombinant CALR. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1G11-1A9 |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human |
Isotype | IgG1 kappa |
Immunogen | CALR (AAH02500.1, 1 a.a. ~ 417 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL |
NCBI | AAH02500.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CALR monoclonal antibody (M01), clone 1G11-1A9 Western Blot analysis of CALR expression in K-562.
Detection limit for recombinant GST tagged CALR is 1 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to CALR on formalin-fixed paraffin-embedded human colon tissue. [antibody concentration 1 ug/ml].
Western Blot analysis of CALR expression in transfected 293T cell line by CALR monoclonal antibody (M01), clone 1G11-1A9. Lane 1: CALR transfected lysate(48 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (71.61 KDa).