CALML3 purified MaxPab mouse polyclonal antibody (B02P)

• Catalog Number: orb2295173
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human CALML3 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: IF, WB
• Reactivity: Human
• Immunogen: CALML3 (NP_005176.1, 1 a.a. ~ 149 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
• NCBI: NP_005176.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CALML3 MaxPab polyclonal antibody. Western Blot analysis of CALML3 expression in A-431.

Immunofluorescence of purified MaxPab antibody to CALML3 on HeLa cell. [antibody concentration 10 ug/ml].

Western Blot analysis of CALML3 expression in transfected 293T cell line by CALML3 MaxPab polyclonal antibody. Lane 1: CALML3 transfected lysate(16.39 KDa). Lane 2: Non-transfected lysate.