CALML3 monoclonal antibody (M04), clone 2A11

• Catalog Number: orb2295170
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant CALML3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2A11
• Tested applications: ELISA, IF, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2b Kappa
• Immunogen: CALML3 (AAH31889, 1 a.a. ~ 149 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
• NCBI: AAH31889
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CALML3 is approximately 0.1 ng/ml as a capture antibody.

Immunofluorescence of monoclonal antibody to CALML3 on HeLa cell. [antibody concentration 10 ug/ml].

Immunoperoxidase of monoclonal antibody to CALML3 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 12 ug/ml].

Western Blot analysis of CALML3 expression in transfected 293T cell line by CALML3 monoclonal antibody (M04), clone 2A11. Lane 1: CALML3 transfected lysate(16.9 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (42.13 KDa).