Calcitonin/Calca Antibody

• Catalog Number: orb443096
• Category: Antibodies
• Description: Calcitonin/Calca Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC
• Reactivity: Human, Mouse, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of mouse Calcitonin (CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• UniProt ID: P70160
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Calcitonin; Calca; Calc
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

IHC analysis of Calcitonin using anti-Calcitonin antibody.Calcitonin was detected in paraffin-embedded section of rat brain tissue.

IHC analysis of Calcitonin using anti-Calcitonin antibody.Calcitonin was detected in paraffin-embedded section of mouse brain tissue.