CALCA monoclonal antibody (M01), clone 4B10

• Catalog Number: orb2295187
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CALCA.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: CALCA (NP_001732, 52 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: AALVQDYVQMKASELEQEQEREGSSLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVSMPQNAN
• Tested applications: ELISA, WB
• Clone Number: 4B10
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_001732
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CALCA is approximately 1 ng/ml as a capture antibody.

Western Blot analysis of CALCA expression in transfected 293T cell line by CALCA monoclonal antibody (M01), clone 4B10. Lane 1: CALCA transfected lysate(15.5 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.64 KDa).