You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295190 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full-length recombinant CALB1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1F6 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | CALB1 (NP_004920.1, 1 a.a. ~ 261 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN |
NCBI | NP_004920.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western Blot detection against Immunogen (56.4 KDa).
Detection limit for recombinant GST tagged CALB1 is 0.3 ng/ml as a capture antibody.
Western Blot analysis of CALB1 expression in transfected 293T cell line by CALB1 monoclonal antibody (M01), clone 1F6. Lane 1: CALB1 transfected lysate (Predicted MW: 30 KDa). Lane 2: Non-transfected lysate.