You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290958 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant CABC1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 7G1 |
Tested applications | ELISA, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgM Kappa |
Immunogen | CABC1 (AAH05171, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MAAILGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAGASTDFSSASAPD |
NCBI | AAH05171 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In ascites fluid |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
CABC1 monoclonal antibody (M04A), clone 7G1 Western Blot analysis of CABC1 expression in Hela S3 NE.
Western Blot detection against Immunogen (36.63 KDa).