CA8 monoclonal antibody (M01), clone 1F7

• Catalog Number: orb2295231
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CA8.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1F7
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG3 Kappa
• Immunogen: CA8 (NP_004047, 40 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: VFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPME
• NCBI: NP_004047
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CA8 monoclonal antibody (M01), clone 1F7 Western Blot analysis of CA8 expression in A-549.

Detection limit for recombinant GST tagged CA8 is approximately 3 ng/ml as a capture antibody.