CA3 purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2295240
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CA3 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human, Mouse
• Immunogen: CA3 (NP_005172.1, 1 a.a. ~ 260 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPLVSNWRPPQPINNRVVRASFK
• NCBI: NP_005172.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CA3 MaxPab rabbit polyclonal antibody. Western Blot analysis of CA3 expression in human liver.

CA3 MaxPab rabbit polyclonal antibody. Western Blot analysis of CA3 expression in mouse lung.

Western Blot analysis of CA3 expression in transfected 293T cell line by CA3 MaxPab polyclonal antibody. Lane 1: CA3 transfected lysate(29.60 KDa). Lane 2: Non-transfected lysate.