CA3 monoclonal antibody (M02), clone 4A12-1A3

• Catalog Number: orb2295239
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant CA3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4A12-1A3
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 kappa
• Immunogen: CA3 (AAH04897, 1 a.a. ~ 260 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLPSAENEPPVPLVSNWRPPQPINNRVVRASFK
• NCBI: AAH04897
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CA3 monoclonal antibody (M02), clone 4A12-1A3 Western Blot analysis of CA3 expression in K-562.

Detection limit for recombinant GST tagged CA3 is approximately 1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to CA3 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3 ug/ml].

Western Blot detection against Immunogen (54.34 KDa).