You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295239 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full-length recombinant CA3. |
Clonality | Monoclonal |
Species/Host | Mouse |
Isotype | IgG1 kappa |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Immunogen | CA3 (AAH04897, 1 a.a. ~ 260 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Protein Sequence | MAKEWGYASHNGPDHWHELFPNAKGENQSPIELHTKDIRHDPSLQPWSVSYDGGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHLVHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDPSCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLPSAENEPPVPLVSNWRPPQPINNRVVRASFK |
Tested applications | ELISA, IHC-P, WB |
Clone Number | 4A12-1A3 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | AAH04897 |
CA3 monoclonal antibody (M02), clone 4A12-1A3 Western Blot analysis of CA3 expression in K-562.
Detection limit for recombinant GST tagged CA3 is approximately 1 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to CA3 on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3 ug/ml].
Western Blot detection against Immunogen (54.34 KDa).