CA12 monoclonal antibody (M01), clone 1D4

• Catalog Number: orb2295222
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant CA12.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1D4
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: CA12 (NP_996808, 25 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: APVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGN
• NCBI: NP_996808
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged CA12 is approximately 1 ng/ml as a capture antibody.

Western Blot analysis of CA12 expression in transfected 293T cell line by CA12 monoclonal antibody (M01), clone 1D4. Lane 1: CA12 transfected lysate(39.5 KDa). Lane 2: Non-transfected lysate.

Western blot analysis of CA12 over-expressed 293 cell line, cotransfected with CA12 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with CA12 monoclonal antibody (M01), clone 1D4 (Cat # orb2295222). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.74 KDa).