CA12 MaxPab rabbit polyclonal antibody (D01)

• Catalog Number: orb2295224
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human CA12 protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IP, WB
• Reactivity: Human
• Immunogen: CA12 (NP_001209.1, 1 a.a. ~ 354 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MPRRSLHAAAVLLLVILKEQPSSPAPVNGSKWTYFGPDGENSWSKKYPSCGGLLQSPIDLHSDILQYDASLTPLEFQGYNLSANKQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHLHWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGSFNPSYDKIFSHLQHVKYKGQEAFVPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFRNPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQVCTAAGLSLGIILSLALAGILGICIVVVVSIWLFRRKSIKKGDNKGVIYKPATKMETEAHA
• NCBI: NP_001209.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: No additive
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CA12 MaxPab rabbit polyclonal antibody. Western Blot analysis of CA12 expression in MCF-7.

Immunoprecipitation of CA12 transfected lysate using anti-CA12 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with CA12 MaxPab mouse polyclonal antibody (B01).

Western Blot analysis of CA12 expression in transfected 293T cell line by CA12 MaxPab polyclonal antibody. Lane 1: CA12 transfected lysate(39.50 KDa). Lane 2: Non-transfected lysate.