You have no items in your shopping cart.
Cart summary
CA1 Recombinant Protein (Rat)
Catalog Number: orb2054278
| Catalog Number | orb2054278 |
|---|---|
| Category | Proteins |
| Description | CA1 Recombinant Protein (Rat) |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 32.2 kDa |
| UniProt ID | B0BNN3 |
| Protein Sequence | ASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF |
| Source | E.coli |
| NCBI | NP_001101130 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | Ca1;CA-I;Carbonate dehydratase I;carbonic anhydras Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Rat Ca1 protein [orb245771]
Greater than 90% as determined by SDS-PAGE.
30.2 kDa
Yeast
20 μg, 100 μg, 1 mgRat CA1 protein [orb418707]
Greater than 90% as determined by SDS-PAGE.
32.2 kDa
E.coli
20 μg, 100 μg, 1 mgRat CA1 protein [orb418708]
Greater than 90% as determined by SDS-PAGE.
44.2 kDa
E.coli
20 μg, 100 μg, 1 mgCA1 Recombinant Protein (Rat) [orb2054276]
Greater than 90% as determined by SDS-PAGE.
32.2 kDa
E.coli
20 μgCA1 Recombinant Protein (Rat) [orb2054277]
Greater than 90% as determined by SDS-PAGE.
32.2 kDa
E.coli
1 mg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
