C3 monoclonal antibody (M01), clone 5F9

• Catalog Number: orb2295301
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant C3.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 5F9
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: C3 (NP_000055, 1534 a.a. ~ 1644 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: DKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQK
• NCBI: NP_000055
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

C3 monoclonal antibody (M01), clone 5F9 Western Blot analysis of C3 expression in A-431.

Detection limit for recombinant GST tagged C3 is approximately 1 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to C3 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml].

Western Blot detection against Immunogen (37.95 KDa).