C20orf194 Rabbit Polyclonal Antibody

SKU: orb574258

Description

Rabbit polyclonal antibody to C20orf194

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Porcine

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C20orf194
• Target: C20orf194
• Protein Sequence: Synthetic peptide located within the following region: SFAKHMVAQCVSPKGPLACSRTYFFGATHVPYLGGDSKLPKKTEQIRLLS
• Molecular Weight: 99kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

C20orf194

WB Suggested Anti-C20orf194 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: SH-SYSY cell lysate.

Quick Database Links

Gene Symbol

C20orf194

UniProt

Q5TEA3

RefSeq:AAI22530