C20ORF194 Rabbit Polyclonal Antibody

• Catalog Number: orb573926
• Category: Antibodies
• Description: Rabbit polyclonal antibody to C20ORF194
• Target: C20ORF194
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat, Yeast
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C20ORF194
• Protein Sequence: Synthetic peptide located within the following region: FVNFFGDKTDFHPLMDQFMNDYVEEANREIEKYNQELEQQEYHDLFELKP
• UniProt ID: Q5TEA3
• MW: 99kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: C20orf194
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: XP_045421

WB Suggested Anti-C20ORF194 Antibody Titration: 2.5 ug/ml, ELISA Titer: 1:312500, Positive Control: Human heart.