You have no items in your shopping cart.
Cart summary
Item 1 of 3
Item 1 of 3
C1QC MaxPab rabbit polyclonal antibody (D01)
Catalog Number: orb2295316
| Catalog Number | orb2295316 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody raised against a full-length human C1QC protein. |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IP, WB |
| Reactivity | Human |
| Immunogen | C1QC (NP_758957.2, 1 a.a. ~ 245 a.a) full-length human protein. |
| Conjugation | Unconjugated |
| Protein Sequence | MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEPGIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQSVFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCVLLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGFLLFPD |
| NCBI | NP_758957.2 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | No additive |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
C1QC MaxPab rabbit polyclonal antibody. Western Blot analysis of C1QC expression in human spleen.
Immunoprecipitation of C1QC transfected lysate using anti-C1QC MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with C1QC purified MaxPab mouse polyclonal antibody (B01P) (orb2295317).
Western Blot analysis of C1QC expression in transfected 293T cell line by C1QC MaxPab polyclonal antibody. Lane 1: C1QC transfected lysate(25.80 KDa). Lane 2: Non-transfected lysate.
