C1QBP MaxPab rabbit polyclonal antibody (D01)

• Catalog Number: orb2295329
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human C1QBP protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: C1QBP (NP_001203.1, 1 a.a. ~ 282 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
• NCBI: NP_001203.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: No additive
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

C1QBP MaxPab rabbit polyclonal antibody. Western Blot analysis of C1QBP expression in Hela S3 NE.

Western Blot analysis of C1QBP expression in transfected 293T cell line by C1QBP MaxPab polyclonal antibody. Lane 1: C1QBP transfected lysate(31.40 KDa). Lane 2: Non-transfected lysate.