C1QB purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2295318
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human C1QB protein.
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: C1QB (NP_000482.3, 1 a.a. ~ 253 a.a) full-length human protein.
• Protein Sequence: MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_000482.3

C1QB MaxPab rabbit polyclonal antibody. Western Blot analysis of C1QB expression in HeLa.

C1QB MaxPab rabbit polyclonal antibody. Western Blot analysis of C1QB expression in human kidney.

C1QB MaxPab rabbit polyclonal antibody. Western Blot analysis of C1QB expression in human pancreas.

C1QB MaxPab rabbit polyclonal antibody. Western Blot analysis of C1QB expression in mouse stomach.

Western Blot analysis of C1QB expression in transfected 293T cell line by C1QB MaxPab polyclonal antibody. Lane 1: C1QB transfected lysate(26.70 KDa). Lane 2: Non-transfected lysate.