C1QA purified MaxPab rabbit polyclonal antibody (D01P)

• Catalog Number: orb2295320
• Category: Antibodies
• Description: Rabbit polyclonal antibody raised against a full-length human C1QA protein.
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: C1QA (NP_057075.1, 1 a.a. ~ 245 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIRTGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAIRRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFLIFPSA
• NCBI: NP_057075.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

C1QA MaxPab rabbit polyclonal antibody. Western Blot analysis of C1QA expression in human kidney.

Western Blot analysis of C1QA expression in transfected 293T cell line by C1QA MaxPab polyclonal antibody. Lane 1: C1QA transfected lysate(26.00 KDa). Lane 2: Non-transfected lysate.