You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2290964 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant C1GALT1. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 1F1 |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | C1GALT1 (NP_064541, 264 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | ETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP |
NCBI | NP_064541 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
C1GALT1 monoclonal antibody (M01), clone 1F1 Western Blot analysis of C1GALT1 expression in HeLa.
Detection limit for recombinant GST tagged C1GALT1 is approximately 0.3 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to C1GALT1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 ug/ml]
Western Blot detection against Immunogen (36.74 KDa).