C1GALT1 monoclonal antibody (M01), clone 1F1

• Catalog Number: orb2290964
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant C1GALT1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1F1
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: C1GALT1 (NP_064541, 264 a.a. ~ 363 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: ETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQANKNEDTKVKLGNP
• NCBI: NP_064541
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

C1GALT1 monoclonal antibody (M01), clone 1F1 Western Blot analysis of C1GALT1 expression in HeLa.

Detection limit for recombinant GST tagged C1GALT1 is approximately 0.3 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to C1GALT1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. [antibody concentration 3 ug/ml]

Western Blot detection against Immunogen (36.74 KDa).