Cart summary

You have no items in your shopping cart.

C17orf53 Rabbit Polyclonal Antibody (FITC)

C17orf53 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2088552

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2088552
CategoryAntibodies
DescriptionC17orf53 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Human, Porcine
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human C17orf53
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW57kDa
UniProt IDQ8N3J3
Protein SequenceSynthetic peptide located within the following region: EVLRETARPQSSALHPLLTFESQQQQVGGFEGPEQDEFDKVLASMELEEP
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesMCM8IP, C17orf53
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.