C Reactive Protein/CRP Antibody

• Catalog Number: orb443166
• Category: Antibodies
• Description: C Reactive Protein/CRP Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Reactivity: Human
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence of human C Reactive Protein (QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA).
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 2-5μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 25 kDa
• UniProt ID: P02741
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: C-reactive protein; C-reactive protein (1-205); CR
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of C Reactive Protein using anti-C Reactive Protein antibody.Lane 1:human U-937 Cell;2:human A431 Cell.

IHC analysis of C Reactive Protein using anti-C Reactive Protein antibody.C Reactive Protein was detected in paraffin-embedded section of rat liver tissue.

IHC analysis of C Reactive Protein using anti-C Reactive Protein antibody.C Reactive Protein was detected in paraffin-embedded section of human liver cancer tissue.

IHC analysis of C Reactive Protein using anti-C Reactive Protein antibody.C Reactive Protein was detected in paraffin-embedded section of mouse small intestine tissue.

IHC analysis of C Reactive Protein using anti-C Reactive Protein antibody.C Reactive Protein was detected in paraffin-embedded section of mouse liver tissue.