You have no items in your shopping cart.
Cart summary
Bunyavirus La Crosse Nucleoprotein/NP Protein (His)
Catalog Number: orb1979595
| Catalog Number | orb1979595 |
|---|---|
| Category | Proteins |
| Description | Encapsidates the genome protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC) and serves as template for transcription and replication. Seems to participate in the nuclear relocalization of host PABP1, thereby inhibiting host cellular translation. Bunyavirus La Crosse Nucleoprotein/NP Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 28.5 kDa and the accession number is P04873. |
| Tag | N-6xHis |
| Purity | 98.00% |
| MW | 28.5 kDa (predicted) |
| UniProt ID | P04873 |
| Protein Sequence | MSDLVFYDVASTGANGFDPDAGYMDFCVKNAESLNLAAVRIFFLNAAKAKAALSRKPERKANPKFGEWQVEVINNHFPGNRNNPIGNNDLTIHRLSGYLARWVLDQYNENDDESQHELIRTTIINPIAESNGVGWDSGPEIYLSFFPGTEMFLETFKFYPLTIGIHRVKQGMMDPQYLKKALRQRYGTLTADKWMSQKVAAIAKSLKDVEQLKWGKGGLSDTAKTFLQKFGIRLP |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | Bunyavirus La Crosse |
| Biological Activity | Encapsidates the genome protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC) and serves as template for transcription and replication. Seems to participate in the nuclear relocalization of host PABP1, thereby inhibiting host cellular translation. Bunyavirus La Crosse Nucleoprotein/NP Protein (His) is expressed in yeast with N-6xHis tag. The predicted molecular weight is 28.5 kDa and the accession number is P04873. |
| Expression Region | 1-235 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Expiration Date | 6 months from date of receipt. |
