You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295344 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant BUB1.This product is belong to Cell Culture Grade Antibody (CX Grade). |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2F9 |
Tested applications | ELISA, IP, WB |
Reactivity | Human |
Isotype | IgG1 Kappa |
Immunogen | BUB1 (AAH28201, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQA |
NCBI | AAH28201 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged BUB1 is 0.03 ng/ml as a capture antibody.
Immunoprecipitation of BUB1 transfected lysate using anti-BUB1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BUB1 MaxPab rabbit polyclonal antibody.
Western Blot analysis of BUB1 expression in transfected 293T cell line by BUB1 monoclonal antibody (M02J), clone 2F9. Lane 1: BUB1 transfected lysate (Predicted MW: 122.4 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (39.93 KDa).