BUB1 monoclonal antibody (M02), clone 2F9

• Catalog Number: orb2295346
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant BUB1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2F9
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: BUB1 (AAH28201, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQA
• NCBI: AAH28201
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BUB1 monoclonal antibody (M02), clone 2F9 Western Blot analysis of BUB1 expression in Hela S3 NE.

Detection limit for recombinant GST tagged BUB1 is approximately 0.1 ng/ml as a capture antibody.

Immunoprecipitation of BUB1 transfected lysate using anti-BUB1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BUB1 MaxPab rabbit polyclonal antibody.

Western Blot analysis of BUB1 expression in transfected 293T cell line by BUB1 monoclonal antibody (M02), clone 2F9. Lane 1: BUB1 transfected lysate(122 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (39.93 KDa).