BTD monoclonal antibody (M01), clone 3B10-2B3

• Catalog Number: orb2295358
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant BTD.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3B10-2B3
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: BTD (AAH12099, 1 a.a. ~ 543 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAHAHIQGGRRAKSRFVVCIMSGARSKLALFLCGCYVVALGAHTGEESVADHHEAEYYVAAVYEHPSILSLNPLALISRQEALELMNQNLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSNGLCCYLLYERPTLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLYERD
• NCBI: AAH12099
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoprecipitation of BTD transfected lysate using anti-BTD monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BTD MaxPab rabbit polyclonal antibody.

Western Blot analysis of BTD expression in transfected 293T cell line by BTD monoclonal antibody (M01), clone 3B10-2B3. Lane 1: BTD transfected lysate(61.1 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (85.47 KDa).