BST2 Antibody

• Catalog Number: orb1536636
• Category: Antibodies
• Description: BST2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IHC, IHC-P, WB
• Reactivity: Human
• Isotype: IgG
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 49-161 of human BST2 (NP_004326.1). NSEACRDGLRAVMECRNVTHLLQQELTEAQKGFQDVEAQAATCNHTVMALMASLDAEKAQGQKKVEELEGEITTLNHKLQDASAEVERLRRENQVLSVRIADKKYYPSSQDSS
• Dilution range: IF (1:50 - 1:200), IHC, IHC-P (1:200), WB (1:500 - 1:2000)
• Conjugation: Unconjugated
• Target: BST2
• Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Buffer/Preservatives: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol. PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Alternative names: BST2, Bone marrow stromal antigen 2, BST-2, CD317
• Note: For research use only
• Application notes: Further information: The predicted MW is 18kDa/19kDa, while the observed MW by Western blot was 36kDa.
• Expiration Date: 12 months from date of receipt.