BST1 monoclonal antibody (M08), clone 4C2

• Catalog Number: orb2295374
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant BST1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4C2
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: BST1 (AAH12095.1, 1 a.a. ~ 318 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSPEQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFADNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYSKDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGEGSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQRAGLIIPLFLVLASRTQL
• NCBI: AAH12095.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunoprecipitation of BST1 transfected lysate using anti-BST1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BST1 MaxPab rabbit polyclonal antibody.

Western Blot detection against Immunogen (60.39 KDa).