BRAF monoclonal antibody (M02), clone 3D2

• Catalog Number: orb2295395
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant BRAF.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3D2
• Tested applications: ELISA, PLA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: BRAF (NP_004324, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: FRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRD
• NCBI: NP_004324
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BRAF monoclonal antibody (M02), clone 3D2. Western Blot analysis of BRAF expression in human pancreas.

Detection limit for recombinant GST tagged BRAF is approximately 0.03 ng/ml as a capture antibody.

Proximity Ligation Analysis of protein-protein interactions between MAPK3 and BRAF. HeLa cells were stained with anti-MAPK3 rabbit purified polyclonal 1:1200 and anti-BRAF mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

Western Blot detection against Immunogen (36.74 KDa).