BRAF monoclonal antibody (M01A), clone 3C6

• Catalog Number: orb2295396
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant BRAF.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3C6
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgM Kappa
• Immunogen: BRAF (NP_004324, 346 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: FRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRD
• NCBI: NP_004324
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BRAF monoclonal antibody (M01A), clone 3C6 Western Blot analysis of BRAF expression in Hela S3 NE.

Detection limit for recombinant GST tagged BRAF is approximately 0.03 ng/ml as a capture antibody.

Western Blot detection against Immunogen (36.74 KDa).