BPHL purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2295399
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human BPHL protein.
• Clonality: Polyclonal
• Species/Host: Mouse
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: BPHL (NP_004323.1, 1 a.a. ~ 274 a.a) full-length human protein.
• Protein Sequence: MPRNLLYSLLSSHLSPHFSTSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: NP_004323.1
• Expiration Date: 12 months from date of receipt.

BPHL MaxPab polyclonal antibody. Western Blot analysis of BPHL expression in human liver.

Western Blot analysis of BPHL expression in transfected 293T cell line by BPHL MaxPab polyclonal antibody. Lane 1: BPHL transfected lysate(30.14 KDa). Lane 2: Non-transfected lysate.