You have no items in your shopping cart.
Cart summary
Bovine coronavirus (strain Mebus) Non-structural Protein 4a (His & SUMOstar)
Catalog Number: orb1979664
| Catalog Number | orb1979664 |
|---|---|
| Category | Proteins |
| Description | Bovine coronavirus (strain Mebus) Non-structural Protein 4a (His & SUMOstar) is expressed in Yeast. |
| Tag | C-6xHis-SUMOstar |
| Purity | 98.00% |
| MW | 17.7 kDa (predicted) |
| UniProt ID | P15778 |
| Protein Sequence | MTTKFVFDLLAPDDILHPFNHVKLIIRPIEVEHIIIATTMPAV |
| Expression System | P. pastoris (Yeast) |
| Biological Origin | BCoV |
| Biological Activity | Bovine coronavirus (strain Mebus) Non-structural Protein 4a (His & SUMOstar) is expressed in Yeast. |
| Expression Region | 1-43 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
