You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1215662 |
---|---|
Category | Proteins |
Description | The Bovine CCL8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine CCL8 applications are for cell culture, ELISA standard, and Western Blot Control. Bovine CCL8 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine CCL8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: QPDSVSTPITCCFSVINGKIPFKKLDSYTRITNSQCPQEAVIFKTKADRDVCADPKQKWVQTSIRLLDQKSRTPKP (76)) (Gene ID: 281044). |
Target | CCL8 |
Form/Appearance | Lyophilized |
Purity | 98% |
Protein Sequence | QPDSVSTPITCCFSVINGKIPFKKLDSYTRITNSQCPQEAVIFKTKADRDVCADPKQKWVQTSIRLLDQKSRTPKP (76) |
Protein Length | 76 |
MW | 8.6 kDa |
Source | Yeast |
Biological Origin | Bovine |
Storage | -20°C |
Note | For research use only |
Bovine | |
15.62-1000pg/mL | |
7.5pg/mL |
Bovine |