BNIP1 purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2295410
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human BNIP1 protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: BNIP1 (AAH10959, 1 a.a. ~ 228 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MAAPQDVHVRICNQEIVKFDLEVKALIQDIRDCSGPLSALTELNTKVKEKFQQLRHRIQDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRKANLTCKIAIDNLEKAELLQGGDLLRQRKTTKESLAQTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALFLATVLYIVKKRLFPFL
• NCBI: AAH10959
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BNIP1 MaxPab polyclonal antibody. Western Blot analysis of BNIP1 expression in human pancreas.

Western Blot analysis of BNIP1 expression in transfected 293T cell line by BNIP1 MaxPab polyclonal antibody. Lane 1: BNIP1 transfected lysate(25.19 KDa). Lane 2: Non-transfected lysate.