You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295418 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant BMPR1B. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 2E2 |
Tested applications | ELISA, WB |
Reactivity | Human, Mouse |
Isotype | IgG2a Kappa |
Immunogen | BMPR1B (AAH47773.1, 24 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | TPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGLPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKNRDFVDGPIHHRA |
NCBI | AAH47773.1 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
BMPR1B monoclonal antibody (M07), clone 2E2. Western Blot analysis of BMPR1B expression in HeLa.
BMPR1B monoclonal antibody (M07), clone 2E2. Western Blot analysis of BMPR1B expression in NIH/3T3.
Detection limit for recombinant GST tagged BMPR1B is approximately 3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (37.07 KDa).