BMPR1B monoclonal antibody (M07), clone 2E2

• Catalog Number: orb2295418
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant BMPR1B.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 2E2
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse
• Isotype: IgG2a Kappa
• Immunogen: BMPR1B (AAH47773.1, 24 a.a. ~ 127 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: TPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGLPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKNRDFVDGPIHHRA
• NCBI: AAH47773.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BMPR1B monoclonal antibody (M07), clone 2E2. Western Blot analysis of BMPR1B expression in HeLa.

BMPR1B monoclonal antibody (M07), clone 2E2. Western Blot analysis of BMPR1B expression in NIH/3T3.

Detection limit for recombinant GST tagged BMPR1B is approximately 3 ng/ml as a capture antibody.

Western Blot detection against Immunogen (37.07 KDa).