BMP2 Antibody

• Catalog Number: orb316550
• Category: Antibodies
• Description: BMP2 Antibody
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ELISA, IHC, WB
• Predicted Reactivity: Hamster
• Reactivity: Human, Rat
• Isotype: Rabbit IgG
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-2 (283-312aa QAKHKQRKRLKSSCKRHPLYVDFSDVGWND), identical to the related mouse and rat sequences.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml, Human, Rat Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, By Heat ELISA(Cap) , 1-5μg/ml, Human, -
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 44702 MW
• UniProt ID: P12643
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Bone morphogenetic protein 2;BMP-2;Bone morphogene
• Note: For research use only
• Application notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

WB analysis of BMP-2 using anti-BMP-2 antibody.Lane 1:Rat Lung Tissue;2:Rat Brain Tissue;3:U87 Cell;4:HELA Cell.

Sandwich ELISA - Recombinant mouse BMP2 protein standard curve.Use in combination with reagents from Mouse BMP2 ELISA Kit EZ-Set (DIY Antibody Pairs).

IHC analysis of BMP-2 using anti-BMP-2 antibody. BMP-2 was detected in a paraffin-embedded section of human intestinal cancer tissue.