You have no items in your shopping cart.
Cart summary
BMP-7 Protein, Human, Recombinant (His)
Catalog Number: orb2816392
| Catalog Number | orb2816392 |
|---|---|
| Category | Proteins |
| Description | BMP-7 Protein, Human, Recombinant (His) is expressed in E. coli with N-6xHis. The accession number is P18075. |
| Tag | N-6xHis |
| MW | 19.7 kDa (Predicted) |
| UniProt ID | P18075 |
| Protein Sequence | STGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKYRNMVVRACGCH |
| Expression System | E. coli |
| Biological Origin | Human |
| Expression Region | 293-431 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 2
Recombinant human BMP-7 protein, His [orb86212]
> 95% as determined by SDS-PAGE
23-25 kDa
500 μg, 100 μg Human BMP 7 (His) Protein [orb424349]
Greater than 95.0% as determined by SDS-PAGE.
Escherichia Coli
10 μg, 50 μg, 1 mg
