You have no items in your shopping cart.
Cart summary
BMP-15 Protein, Human, Recombinant (His & Myc)
Catalog Number: orb1978901
| Catalog Number | orb1978901 |
|---|---|
| Category | Proteins |
| Description | May be involved in follicular development. Oocyte-specific growth/differentiation factor that stimulates folliculogenesis and granulosa cell (GC) growth. BMP-15 Protein, Human, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 21.4 kDa and the accession number is O95972. |
| Tag | N-10xHis, C-Myc |
| Purity | 98.00% |
| MW | 21.4 kDa (predicted) |
| UniProt ID | O95972 |
| Protein Sequence | QADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR |
| Expression System | E. coli |
| Biological Origin | Human |
| Biological Activity | May be involved in follicular development. Oocyte-specific growth/differentiation factor that stimulates folliculogenesis and granulosa cell (GC) growth. BMP-15 Protein, Human, Recombinant (His & Myc) is expressed in E. coli expression system with N-10xHis and C-Myc tag. The predicted molecular weight is 21.4 kDa and the accession number is O95972. |
| Expression Region | 268-392 aa |
| Storage | -20°C |
| Note | For research use only |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/mL. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expiration Date | 6 months from date of receipt. |
