You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2051462 |
---|---|
Category | Proteins |
Description | BLVRA Recombinant Protein (Human) |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 60.4 kDa |
UniProt ID | P53004 |
Protein Sequence | MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK |
Source | E.coli |
NCBI | NP_000703 |
Storage | -20°C or -80°C |
Buffer/Preservatives | Liquid or Lyophilized powder |
Alternative names | biliverdin reductase A;biliverdin-IX alpha-reducta Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
Greater than 90% as determined by SDS-PAGE. | |
60.4 kDa | |
E.coli |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
E. coli |
≥90% as determined by SDS-PAGE | |
This protein contains the human BLVRA(Glu6-Ser294) was fused with the C-terminal His Tag and expressed in E. coli. |
Greater than 90% as determined by SDS-PAGE. | |
60.4 kDa | |
E.coli |
Filter by Rating