You have no items in your shopping cart.
Cart summary
BLVRA Recombinant Protein (Human)
Catalog Number: orb2051462
| Catalog Number | orb2051462 |
|---|---|
| Category | Proteins |
| Description | BLVRA Recombinant Protein (Human) |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 60.4 kDa |
| UniProt ID | P53004 |
| Protein Sequence | MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK |
| Source | E.coli |
| NCBI | NP_000703 |
| Storage | -20°C or -80°C |
| Buffer/Preservatives | Liquid or Lyophilized powder |
| Alternative names | biliverdin reductase A;biliverdin-IX alpha-reducta Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
Human BLVRA protein [orb54412]
Greater than 90% as determined by SDS-PAGE.
60.4 kDa
E.coli
20 μg, 100 μg, 1 mgHuman BLVRA protein [orb391300]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgRecombinant Human BLVRA Protein, His Tag [orb1552833]
≥90% as determined by SDS-PAGE
This protein contains the human BLVRA(Glu6-Ser294) was fused with the C-terminal His Tag and expressed in E. coli.
100 μg, 50 μgBLVRA Recombinant Protein (Human) [orb2051461]
Greater than 90% as determined by SDS-PAGE.
60.4 kDa
E.coli
20 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars
