BLVRA monoclonal antibody (M03), clone S2

• Catalog Number: orb2295471
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant BLVRA.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: S2
• Tested applications: ELISA, IP, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: BLVRA (AAH08456, 1 a.a. ~ 296 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
• NCBI: AAH08456
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged BLVRA is 3 ng/ml as a capture antibody.

Immunoprecipitation of BLVRA transfected lysate using anti-BLVRA monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with BLVRA MaxPab rabbit polyclonal antibody.

Western Blot analysis of BLVRA expression in transfected 293T cell line by BLVRA monoclonal antibody (M03), clone S2. Lane 1: BLVRA transfected lysate(33.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (58.3 KDa).