BLVRA monoclonal antibody (M01), clone 4G4-2B6

• Catalog Number: orb2295473
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full length recombinant BLVRA.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 4G4-2B6
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a kappa
• Immunogen: BLVRA (AAH08456, 1 a.a. ~ 296 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
• NCBI: AAH08456
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BLVRA monoclonal antibody (M01), clone 4G4-2B6 Western Blot analysis of BLVRA expression in 293.

BLVRA monoclonal antibody (M01), clone 4G4-2B6. Western Blot analysis of BLVRA expression in HeLa.

Western Blot analysis of BLVRA expression in transfected 293T cell line by BLVRA monoclonal antibody (M01), clone 4G4-2B6. Lane 1: BLVRA transfected lysate(33.4 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (58.3 KDa).