You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2295472 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a full-length recombinant BLVRA. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | S1 |
Tested applications | ELISA, WB |
Reactivity | Human |
Isotype | IgG2a Kappa |
Immunogen | BLVRA (AAH08456, 1 a.a. ~ 296 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK |
NCBI | AAH08456 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In ascites fluid |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
BLVRA monoclonal antibody (M01A), clone 4G4-2B6 Western Blot analysis of BLVRA expression in 293.
BLVRA monoclonal antibody (M01A), clone 4G4-2B6. Western Blot analysis of BLVRA expression in HeLa.
Western Blot detection against Immunogen (58.3 KDa).