BLVRA monoclonal antibody (M01A), clone S1

• Catalog Number: orb2295472
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a full-length recombinant BLVRA.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: S1
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: BLVRA (AAH08456, 1 a.a. ~ 296 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MNAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
• NCBI: AAH08456
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In ascites fluid
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BLVRA monoclonal antibody (M01A), clone 4G4-2B6 Western Blot analysis of BLVRA expression in 293.

BLVRA monoclonal antibody (M01A), clone 4G4-2B6. Western Blot analysis of BLVRA expression in HeLa.

Western Blot detection against Immunogen (58.3 KDa).