BLK monoclonal antibody (M02), clone 7A12

• Catalog Number: orb2295483
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant BLK.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 7A12
• Tested applications: ELISA, WB
• Reactivity: Human, Mouse, Rat
• Isotype: IgG1 Kappa
• Immunogen: BLK (AAH07371, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPPPPDEHLDEDKHFVVALYDYTAMNDRDLQMLKGEKLQVLKG
• NCBI: AAH07371
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BLK monoclonal antibody (M02), clone 7A12. Western Blot analysis of BLK expression in PC-12.

BLK monoclonal antibody (M02), clone 7A12. Western Blot analysis of BLK expression in Raw 264.7.

Detection limit for recombinant GST tagged BLK is approximately 0.03 ng/ml as a capture antibody.

Western Blot analysis of BLK expression in transfected 293T cell line by BLK monoclonal antibody (M02), clone 7A12. Lane 1: BLK transfected lysate (Predicted MW: 57.7 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (35.53 KDa).