BIN1 monoclonal antibody (M01), clone 1H1

• Catalog Number: orb2296100
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant BIN1.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 1H1
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: BIN1 (NP_004296, 355 a.a. ~ 454 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: VVETFPATVNGTVEGGSGAGRLDLPPGFMFKVQAQHDYTATDTDELQLKAGDVVLVIPFQNPEEQDEGWLMGVKESDWNQHKELEKCRGVFPENFTERVP
• NCBI: NP_004296
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

BIN1 monoclonal antibody (M01), clone 1H1 Western Blot analysis of BIN1 expression in Hela S3 NE.

Western Blot analysis of BIN1 expression in transfected 293T cell line by BIN1 monoclonal antibody (M01), clone 1H1. Lane 1: BIN1 transfected lysate(53 KDa). Lane 2: Non-transfected lysate.

Western Blot detection against Immunogen (36.74 KDa).